Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTBL2 Peptide - C-terminal region

ACTBL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACT

UniProt

Q562R1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTBL2 Rabbit Polyclonal Antibody (orb587291) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017992

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPPIVHRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SIRP alpha/CD172a Antibody (602411) [DyLight 405]
FAB4546E 0.1 mL

Mouse Monoclonal SIRP alpha/CD172a Antibody (602411) [DyLight 405]

Sign In for Pricing
View Details
MRF/C11orf9 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-11191R-BF680-TR 20 µL

MRF/C11orf9 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
C1INH Double Nickase Plasmid (m2)
sc-419384-NIC-2 20 µg

C1INH Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Ralgapa2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4773602 1.0 µg DNA

Ralgapa2 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Zinc finger CCCH domain-containing protein 55 (Os08g0135800, LOC_Os08g04170), partial
MBS1456119 Inquire

Recombinant Oryza sativa subsp. japonica Zinc finger CCCH domain-containing protein 55 (Os08g0135800, LOC_Os08g04170), partial

Sign In for Pricing
View Details
1- (3-Chloro-4-benzyloxyphenyl) propan-1-one
OR1002812-01 250 mg

1- (3-Chloro-4-benzyloxyphenyl) propan-1-one

Sign In for Pricing
View Details