Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACTBL2 Peptide - C-terminal region

ACTBL2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACT

UniProt

Q562R1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACTBL2 Rabbit Polyclonal Antibody (orb587291) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017992

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPPIVHRK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPSM3 (AGS4, C6orf9, G18, G-protein-signaling Modulator 3, Activator of G-protein Signaling 4, G18.1b, Protein G18) (MaxLight 550)
127510-ML550 100 µL

GPSM3 (AGS4, C6orf9, G18, G-protein-signaling Modulator 3, Activator of G-protein Signaling 4, G18.1b, Protein G18) (MaxLight 550)

Sign In for Pricing
View Details
Anti-TSH-Receptor, A-Chain (Thyroid Marker) Monoclonal Antibody (Clone: TSHRA/1402)
36-3317-20 20 µg

Anti-TSH-Receptor, A-Chain (Thyroid Marker) Monoclonal Antibody (Clone: TSHRA/1402)

Sign In for Pricing
View Details
MRP-L40 siRNA (h)
sc-75828 10 µM

MRP-L40 siRNA (h)

Sign In for Pricing
View Details
Adenovirus
MBS320086-01 0.1 mg

Adenovirus

Sign In for Pricing
View Details
Adenovirus
MBS320086-02 5x 0.1 mg

Adenovirus

Sign In for Pricing
View Details
Saposin-D polyclonal rabbit antiserum
431 002 200 µL

Saposin-D polyclonal rabbit antiserum

Sign In for Pricing
View Details