SOWAHD Peptide - C-terminal region
SOWAHD Peptide - C-terminal region
Product Specifications
Product Name Alternative
ANKRD58
UniProt
A6NJG2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SOWAHD Rabbit Polyclonal Antibody (orb326908) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001099046
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: NLNNNSSGTTAWRAASAVGATAVETSRRVAASRTKAKDTAGSRVAQMHSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
41957121 3x 1.0µg DNA
RPL9P4 CRISPRa sgRNA lentivector (set of three targets)(Human)
Sign In for Pricing
View Details 
LV717030 1.0 µg DNA
ZMYM6 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
Sign In for Pricing
View Details 28562061 1.0 µg DNA
MHS4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
Sign In for Pricing
View Details 
K4762803 1.0 µg DNA
Bmp7 sgRNA CRISPR Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details