Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SOWAHD Peptide - C-terminal region

SOWAHD Peptide - C-terminal region

Product Specifications

Product Name Alternative

ANKRD58

UniProt

A6NJG2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SOWAHD Rabbit Polyclonal Antibody (orb326908) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099046

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLNNNSSGTTAWRAASAVGATAVETSRRVAASRTKAKDTAGSRVAQMHSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pacific Blue™ anti-mouse CD150 (SLAM)
GT02272 100 µg

Pacific Blue™ anti-mouse CD150 (SLAM)

Sign In for Pricing
View Details
Rat Pde3b Pre-designed siRNA Set B
SI210216B 1 Each

Rat Pde3b Pre-designed siRNA Set B

Sign In for Pricing
View Details
HSBP1 (NM_001537) Human Recombinant Protein
PROTO75506 20 µg

HSBP1 (NM_001537) Human Recombinant Protein

Sign In for Pricing
View Details
ELAC1 Antibody (Biotin)
orb354720-01 50 µg

ELAC1 Antibody (Biotin)

Sign In for Pricing
View Details
ELAC1 Antibody (Biotin)
orb354720-02 100 µg

ELAC1 Antibody (Biotin)

Sign In for Pricing
View Details
Carboxypeptidase B2/CPB2 Rabbit Polyclonal Antibody
orb371731 100 µg

Carboxypeptidase B2/CPB2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details