Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFB3 Peptide - C-terminal region

BPIFB3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf185, LPLUNC3, RYA3, dJ726C3.4

UniProt

P59826

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BPIFB3 Rabbit Polyclonal Antibody (orb326912) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872599

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IELDINPIVKSVAGDIIDFPKSRAPAKVPPKKDHTSQVMVPLYLFNTTFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl [2-Diethylaminothiocarboxyl)]phenylacetate
TRC-E916450-1G 1 g

Ethyl [2-Diethylaminothiocarboxyl)]phenylacetate

Sign In for Pricing
View Details
Tissue FFPE Sections, Joint
CS707213 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
FITC Anti-Mouse CD226 Antibody[480.1]
E-AB-F1419C-01 50 Tests

FITC Anti-Mouse CD226 Antibody[480.1]

Sign In for Pricing
View Details
FITC Anti-Mouse CD226 Antibody[480.1]
E-AB-F1419C-02 100 Tests

FITC Anti-Mouse CD226 Antibody[480.1]

Sign In for Pricing
View Details
FITC Anti-Mouse CD226 Antibody[480.1]
E-AB-F1419C-03 2x 100 Tests

FITC Anti-Mouse CD226 Antibody[480.1]

Sign In for Pricing
View Details
Pancreatic alpha amylase (AMY2A) Human Gene Knockout Kit (CRISPR)
KN402805 1 Kit

Pancreatic alpha amylase (AMY2A) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details