Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BPIFB3 Peptide - C-terminal region

BPIFB3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf185, LPLUNC3, RYA3, dJ726C3.4

UniProt

P59826

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BPIFB3 Rabbit Polyclonal Antibody (orb326912) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872599

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IELDINPIVKSVAGDIIDFPKSRAPAKVPPKKDHTSQVMVPLYLFNTTFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Septin10 Mouse Gene Knockout Kit (CRISPR)
KN515526 1 Kit

Septin10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RAD51 Rabbit Polyclonal Antibody
AP21140PU-N 100 µg

RAD51 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
WT1 (Wilm's Tumor 1) (WT1/857), CF568 conjugate, 0.1mg/mL
BNC680857-500 1x 500 µL

WT1 (Wilm's Tumor 1) (WT1/857), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Rat BAX (Bcl-2 Associated X Protein) ELISA Kit
E-EL-R0098-01 24 Tests

Rat BAX (Bcl-2 Associated X Protein) ELISA Kit

Sign In for Pricing
View Details
Rat BAX (Bcl-2 Associated X Protein) ELISA Kit
E-EL-R0098-02 48 Tests

Rat BAX (Bcl-2 Associated X Protein) ELISA Kit

Sign In for Pricing
View Details
Rat BAX (Bcl-2 Associated X Protein) ELISA Kit
E-EL-R0098-03 96 Tests

Rat BAX (Bcl-2 Associated X Protein) ELISA Kit

Sign In for Pricing
View Details