CCDC178 Peptide - C-terminal region
CCDC178 Peptide - C-terminal region
Product Specifications
UniProt
Q5BJE1
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CCDC178 Rabbit Polyclonal Antibody (orb326913) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_945346
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VVLFSQMRLANFQTDSQESIQKILAVQEESSNLMQHILGFFQTLTDGTCE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY424327 100 µg
BLOC1S2 (NM_001001342) Human Over-expression Lysate
Sign In for Pricing
View Details 
![PE Anti-Mouse CD4 Antibody[GK1.5]](https://cdn.genprice.uk/products/763/68dd14af061270361e7d36a6/imageurl/e-ab-f1097d.webp)