Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC178 Peptide - C-terminal region

CCDC178 Peptide - C-terminal region

Product Specifications

UniProt

Q5BJE1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC178 Rabbit Polyclonal Antibody (orb326913) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_945346

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVLFSQMRLANFQTDSQESIQKILAVQEESSNLMQHILGFFQTLTDGTCE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse Clusterin Protein (His Tag)
PDMM100164-01 20 µg

Recombinant Mouse Clusterin Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Clusterin Protein (His Tag)
PDMM100164-02 100 µg

Recombinant Mouse Clusterin Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Clusterin Protein (His Tag)
PDMM100164-03 500 µg

Recombinant Mouse Clusterin Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Clusterin Protein (His Tag)
PDMM100164-04 1 mg

Recombinant Mouse Clusterin Protein (His Tag)

Sign In for Pricing
View Details
RPA70 (RPA1) Rabbit Polyclonal Antibody
TA381018 100 µL

RPA70 (RPA1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Syntaxin 3 (STX3) (NM_001178040) Human Over-expression Lysate
LY432811 100 µg

Syntaxin 3 (STX3) (NM_001178040) Human Over-expression Lysate

Sign In for Pricing
View Details