Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TEX38 Peptide - middle region

TEX38 Peptide - middle region

Product Specifications

Product Name Alternative

C1orf223, THEG4

UniProt

Q6PEX7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TEX38 Rabbit Polyclonal Antibody (orb326914) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001138946

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PDVLWDLDIPEGRSHADQDSNPKAEAPAPLQPALQLAPQQPQARSPFPLP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr738 Lentiviral Activation Particles (m)
sc-434784-LAC 200 µL

Olfr738 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Mouse Monoclonal IL1F6 Antibody (OTI1A4) [DyLight 550]
NBP2-71834R 0.1 mL

Mouse Monoclonal IL1F6 Antibody (OTI1A4) [DyLight 550]

Sign In for Pricing
View Details
FAF1 siRNA (m)
sc-37521 10 µM

FAF1 siRNA (m)

Sign In for Pricing
View Details
SUSD5 Human Over-expression Lysate
orb1348533 100 µg

SUSD5 Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Interleukin 24 ELISA kit
GTR10398166 96 Well

Rat Interleukin 24 ELISA kit

Sign In for Pricing
View Details
Septin7 Mouse qPCR Primer Pair (NM_009859)
MP215165 200 Reactions

Septin7 Mouse qPCR Primer Pair (NM_009859)

Sign In for Pricing
View Details