TEX38 Peptide - middle region
TEX38 Peptide - middle region
Product Specifications
Product Name Alternative
C1orf223, THEG4
UniProt
Q6PEX7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TEX38 Rabbit Polyclonal Antibody (orb326914) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001138946
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PDVLWDLDIPEGRSHADQDSNPKAEAPAPLQPALQLAPQQPQARSPFPLP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2514076-01 24 Tests
Monkey PCDHbeta16 (Protocadherin Beta 16) ELISA Kit
Sign In for Pricing
View Details MBS2514076-02 48 Tests
Monkey PCDHbeta16 (Protocadherin Beta 16) ELISA Kit
Sign In for Pricing
View Details MBS2514076-03 96 Tests
Monkey PCDHbeta16 (Protocadherin Beta 16) ELISA Kit
Sign In for Pricing
View Details MBS2514076-04 5x 96 Tests
Monkey PCDHbeta16 (Protocadherin Beta 16) ELISA Kit
Sign In for Pricing
View Details MBS2514076-05 10x 96 Tests
Monkey PCDHbeta16 (Protocadherin Beta 16) ELISA Kit
Sign In for Pricing
View Details 