Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A25 Peptide - middle region

SLC22A25 Peptide - middle region

Product Specifications

Product Name Alternative

HIMTP, UST6

UniProt

Q6T423

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC22A25 Rabbit Polyclonal Antibody (orb326915) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_955384

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VFFLFSRWLAESARWLIINNKPEEGLKELRKAAHRNGMKNAEDILTMEVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMUB2 (NM_024107) Human Recombinant Protein
TP319462 20 µg

TMUB2 (NM_024107) Human Recombinant Protein

Sign In for Pricing
View Details
MART-1 / Melan-A (A103), CF740 conjugate, 0.1mg/mL
BNC740668-500 1x 500 µL

MART-1 / Melan-A (A103), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CPSF6 Rabbit Polyclonal Antibody
TA375053 100 µL

CPSF6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2783), Biotin conjugate, 0.1mg/mL
BNCB2783-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2783), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Hexane-d14
TRC-H294473-10MG 10 mg

N-Hexane-d14

Sign In for Pricing
View Details
Tryptase (Mast Cell Marker) (TPSAB1/1963), CF640R conjugate, 0.1mg/mL
BNC401963-100 1x 100 µL

Tryptase (Mast Cell Marker) (TPSAB1/1963), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details