Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC22A25 Peptide - middle region

SLC22A25 Peptide - middle region

Product Specifications

Product Name Alternative

HIMTP, UST6

UniProt

Q6T423

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC22A25 Rabbit Polyclonal Antibody (orb326915) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_955384

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VFFLFSRWLAESARWLIINNKPEEGLKELRKAAHRNGMKNAEDILTMEVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), Biotin conjugate, 0.1mg/mL
BNCB1867-500 1x 500 µL

CD8A (Cytotoxic-&Suppressor T-Cell Marker) (rC8/468), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DUSP16 Rabbit Polyclonal Antibody
TA375652 100 µL

DUSP16 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STX2 Antibody
OC-214-01 50 μL

STX2 Antibody

Sign In for Pricing
View Details
STX2 Antibody
OC-214-02 100 µL

STX2 Antibody

Sign In for Pricing
View Details
STX2 Antibody
OC-214-03 1 mL

STX2 Antibody

Sign In for Pricing
View Details
AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF488A conjugate, 0.1mg/mL
BNC882346-100 1x 100 µL

AIF1 / Iba1 (Microglia Marker) (rAIF1/1909), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details