Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SKIDA1 Peptide - C-terminal region

SKIDA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C10orf140, DLN-1

UniProt

E9PAX1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SKIDA1 Rabbit Polyclonal Antibody (orb326917) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997254

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KFGARVRKNYRTLVLGKRPVLQTPPVKPNLKSARSPRPTGKTETNEGTLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF405S conjugate, 0.1mg/mL
BNC041725-500 1x 500 µL

Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mammaglobin A Recombinant Mouse Monoclonal Antibody [A9A2-R]
HA601136 100 µL

Mammaglobin A Recombinant Mouse Monoclonal Antibody [A9A2-R]

Sign In for Pricing
View Details
cis-Diethyl Stilbestrol
TRC-D445025-10MG 10 mg

cis-Diethyl Stilbestrol

Sign In for Pricing
View Details
2,4-Bis(2-ethylhexyl) Benzene-1,2,4-tricarboxylic Acid 1-Benzyl Ester-d34
TRC-B433862-5MG 5 mg

2,4-Bis(2-ethylhexyl) Benzene-1,2,4-tricarboxylic Acid 1-Benzyl Ester-d34

Sign In for Pricing
View Details
PKMYT1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B4]
TA500839BM 100 µL

PKMYT1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B4]

Sign In for Pricing
View Details
A RAF (ARAF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F5]
TA803675BM 100 µL

A RAF (ARAF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2F5]

Sign In for Pricing
View Details