Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SKIDA1 Peptide - C-terminal region

SKIDA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C10orf140, DLN-1

UniProt

E9PAX1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SKIDA1 Rabbit Polyclonal Antibody (orb326917) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997254

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KFGARVRKNYRTLVLGKRPVLQTPPVKPNLKSARSPRPTGKTETNEGTLD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR (31G7), CF594 conjugate, 0.1mg/mL
BNC941194-100 1x 100 µL

EGFR (31G7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
7-(4-Chlorobutoxy)-3,4-dihydro-2(1H)-quinolinone
TRC-C365560-1G 1 g

7-(4-Chlorobutoxy)-3,4-dihydro-2(1H)-quinolinone

Sign In for Pricing
View Details
5-Aza Cytosine
TRC-A796375-5G 5 g

5-Aza Cytosine

Sign In for Pricing
View Details
Kaiso (ZBTB33) (NM_001184742) Human Over-expression Lysate
LC433416 20 µg

Kaiso (ZBTB33) (NM_001184742) Human Over-expression Lysate

Sign In for Pricing
View Details
SLC22A14 Human Gene Knockout Kit (CRISPR)
KN423019 1 Kit

SLC22A14 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
C2orf84 (FAM228A) (NM_001040710) Human Recombinant Protein
TP760974 50 µg

C2orf84 (FAM228A) (NM_001040710) Human Recombinant Protein

Sign In for Pricing
View Details