Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSYN1 Peptide - C-terminal region

INSYN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C15orf59

UniProt

Q2T9L4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INSYN1 Rabbit Polyclonal Antibody (orb326922) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001034703

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLTSRHSGSTLAPEQTRRVTRNSSTQTVSDKSTQTVLPYTATRQKARGKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HLA E Polyclonal Antibody, Cy3 Conjugated
bs-42249R-Cy3 100 µL

HLA E Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Chicken Bb (Bilirubin) ELISA Kit
MBS8807662-01 48 Well

Chicken Bb (Bilirubin) ELISA Kit

Sign In for Pricing
View Details
Chicken Bb (Bilirubin) ELISA Kit
MBS8807662-02 96 Well

Chicken Bb (Bilirubin) ELISA Kit

Sign In for Pricing
View Details
Chicken Bb (Bilirubin) ELISA Kit
MBS8807662-03 5x 96 Well

Chicken Bb (Bilirubin) ELISA Kit

Sign In for Pricing
View Details
Chicken Bb (Bilirubin) ELISA Kit
MBS8807662-04 10x 96 Well

Chicken Bb (Bilirubin) ELISA Kit

Sign In for Pricing
View Details
Phospho-CDCP1 (Tyr743) Blocking Peptide
MBS9616574-01 1 mg

Phospho-CDCP1 (Tyr743) Blocking Peptide

Sign In for Pricing
View Details