Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSYN1 Peptide - C-terminal region

INSYN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C15orf59

UniProt

Q2T9L4

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INSYN1 Rabbit Polyclonal Antibody (orb326922) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001034703

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLTSRHSGSTLAPEQTRRVTRNSSTQTVSDKSTQTVLPYTATRQKARGKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSMF1 Adenovirus (Rat)
38022056 1.0 mL

PSMF1 Adenovirus (Rat)

Sign In for Pricing
View Details
Lentiviral mouse Srp14 shRNA (UAS) - Lentiviral mouse Srp14 shRNA (UAS, iRFP) plasmid
GTR15221752 1 Vial

Lentiviral mouse Srp14 shRNA (UAS) - Lentiviral mouse Srp14 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Smoothelin (h) -PR
sc-36512-PR 10 µM - 20 µL

Smoothelin (h) -PR

Sign In for Pricing
View Details
OBP2A (NM_001293189) Human Tagged ORF Clone
RG236729 10 µg

OBP2A (NM_001293189) Human Tagged ORF Clone

Sign In for Pricing
View Details
SPESP1 Human Recombinant Protein
TP726846 10 µg

SPESP1 Human Recombinant Protein

Sign In for Pricing
View Details
Pretomanid Impurity 39
RM-P456039-01 10 mg

Pretomanid Impurity 39

Sign In for Pricing
View Details