INSYN1 Peptide - C-terminal region
INSYN1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
C15orf59
UniProt
Q2T9L4
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with INSYN1 Rabbit Polyclonal Antibody (orb326922) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001034703
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PLTSRHSGSTLAPEQTRRVTRNSSTQTVSDKSTQTVLPYTATRQKARGKN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
OR1074651-01 5 mg
(S) -2-Amino-3- (4- (4- (4-hydroxy-3,5-diiodophenoxy) -3,5-diiodophenoxy) -3,5-diiodophenyl) propanoic acid
Sign In for Pricing
View Details OR1074651-02 10 mg
(S) -2-Amino-3- (4- (4- (4-hydroxy-3,5-diiodophenoxy) -3,5-diiodophenoxy) -3,5-diiodophenyl) propanoic acid
Sign In for Pricing
View Details OR1074651-03 25 mg
(S) -2-Amino-3- (4- (4- (4-hydroxy-3,5-diiodophenoxy) -3,5-diiodophenoxy) -3,5-diiodophenyl) propanoic acid
Sign In for Pricing
View Details OR1074651-04 50 mg
(S) -2-Amino-3- (4- (4- (4-hydroxy-3,5-diiodophenoxy) -3,5-diiodophenoxy) -3,5-diiodophenyl) propanoic acid
Sign In for Pricing
View Details OR1074651-05 100 mg
(S) -2-Amino-3- (4- (4- (4-hydroxy-3,5-diiodophenoxy) -3,5-diiodophenoxy) -3,5-diiodophenyl) propanoic acid
Sign In for Pricing
View Details 
bs-2043R-BF350-01 20 µL
CK18 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
Sign In for Pricing
View Details