BEND4 Peptide - C-terminal region
BEND4 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CCDC4
UniProt
Q6ZU67
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BEND4 Rabbit Polyclonal Antibody (orb587302) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_997289
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GKRKRSVQSGETGPERRPLDPVKVTCLREFIRMHCTSNPDWWMPSEEQIN
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC043127-100 1x 100 µL
CD74 (B-Cell Marker) (CLIP/3127R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881149-500 1x 500 µL
CD71 (TFRC/1149), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042988-500 1x 500 µL
BCL10 (MALT-Lymphoma Marker) (BL10/2988R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![LEPRE1 (P3H1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B4]](https://cdn.genprice.uk/products/937/6868c367994c49e6dc3f6091/imageurl/ta505105am.webp)
TA505105AM 100 µL
LEPRE1 (P3H1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B4]
Sign In for Pricing
View Details