Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BEND4 Peptide - C-terminal region

BEND4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CCDC4

UniProt

Q6ZU67

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BEND4 Rabbit Polyclonal Antibody (orb587302) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997289

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GKRKRSVQSGETGPERRPLDPVKVTCLREFIRMHCTSNPDWWMPSEEQIN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 (KRT18) (rKRT18/1190), CF640R conjugate, 0.1mg/mL
BNC403217-500 1x 500 µL

Cytokeratin 18 (KRT18) (rKRT18/1190), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/777), 1mg/mL
BNUM0777-50 1x 50 µL

Chromogranin A (CHGA/777), 1mg/mL

Sign In for Pricing
View Details
DLK (DLK1) Human Gene Knockout Kit (CRISPR)
KN402923 1 Kit

DLK (DLK1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SPARCL1 Antibody
KC-22011-01 50 μL

SPARCL1 Antibody

Sign In for Pricing
View Details
SPARCL1 Antibody
KC-22011-02 100 µL

SPARCL1 Antibody

Sign In for Pricing
View Details
SPARCL1 Antibody
KC-22011-03 1 mL

SPARCL1 Antibody

Sign In for Pricing
View Details