Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR51B6 Peptide - C-terminal region

OR51B6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HOR5'Beta6

UniProt

Q9H340

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR51B6 Rabbit Polyclonal Antibody (orb587303) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004750

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLFAMVLLDFLIIFFSYILILKTVMGIGSGGERAKALNTCVSHICCILVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACAA2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C6]
TA506158BM 100 µL

ACAA2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3C6]

Sign In for Pricing
View Details
BST1 Antibody
orb127768-01 25 µg

BST1 Antibody

Sign In for Pricing
View Details
BST1 Antibody
orb127768-02 50 µg

BST1 Antibody

Sign In for Pricing
View Details
BST1 Antibody
orb127768-03 100 µg

BST1 Antibody

Sign In for Pricing
View Details
BST1 Antibody
orb127768-04 200 µg

BST1 Antibody

Sign In for Pricing
View Details
Rabbit Cell differentiation protein RCD1 homolog (RQCD1) ELISA kit
GTR10439648 96 Well

Rabbit Cell differentiation protein RCD1 homolog (RQCD1) ELISA kit

Sign In for Pricing
View Details