Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR51B6 Peptide - C-terminal region

OR51B6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HOR5'Beta6

UniProt

Q9H340

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR51B6 Rabbit Polyclonal Antibody (orb587303) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004750

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLFAMVLLDFLIIFFSYILILKTVMGIGSGGERAKALNTCVSHICCILVF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Dickkopf-Related Protein 1 HEK
7-04986 100 µg

Recombinant Human Dickkopf-Related Protein 1 HEK

Sign In for Pricing
View Details
ATG4B Human Knockdown Lysate
LY300057 100 µg

ATG4B Human Knockdown Lysate

Sign In for Pricing
View Details
Recombinant Mouse Flt3 ligand/FLT3L Protein, N-His
orb2830386-01 20 µg

Recombinant Mouse Flt3 ligand/FLT3L Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse Flt3 ligand/FLT3L Protein, N-His
orb2830386-02 50 µg

Recombinant Mouse Flt3 ligand/FLT3L Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse Flt3 ligand/FLT3L Protein, N-His
orb2830386-03 100 µg

Recombinant Mouse Flt3 ligand/FLT3L Protein, N-His

Sign In for Pricing
View Details
Arhgap4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
12307116 3x 1.0 µg

Arhgap4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details