Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6C1 Peptide - C-terminal region

OR6C1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OST267

UniProt

Q96RD1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR6C1 Rabbit Polyclonal Antibody (orb587305) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005182

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSTSQRTKAFSTCSSHMVVVSISYGSCIFMYIKPSAKDRVSLSKGVAILN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIK3CB Antibody
DF2626-01 100 µL

PIK3CB Antibody

Sign In for Pricing
View Details
PIK3CB Antibody
DF2626-02 200 µL

PIK3CB Antibody

Sign In for Pricing
View Details
SPOP Rabbit pAb
E2251468 100 µL

SPOP Rabbit pAb

Sign In for Pricing
View Details
Mmu-miR-7036a-3p miRNA Antagomir
orb1912179-01 10 nmol

Mmu-miR-7036a-3p miRNA Antagomir

Sign In for Pricing
View Details
Mmu-miR-7036a-3p miRNA Antagomir
orb1912179-02 20 nmol

Mmu-miR-7036a-3p miRNA Antagomir

Sign In for Pricing
View Details
CNN2 Recombinant Protein
OPCD02279-10UG 10 µg

CNN2 Recombinant Protein

Sign In for Pricing
View Details