Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OR6C1 Peptide - C-terminal region

OR6C1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

OST267

UniProt

Q96RD1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with OR6C1 Rabbit Polyclonal Antibody (orb587305) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001005182

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSTSQRTKAFSTCSSHMVVVSISYGSCIFMYIKPSAKDRVSLSKGVAILN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Caspase 2 Antibody
E51A02813 100 µL

Caspase 2 Antibody

Sign In for Pricing
View Details
Mouse Annexin A11 (ANXA11) ELISA Kit
abx501948 96 Tests

Mouse Annexin A11 (ANXA11) ELISA Kit

Sign In for Pricing
View Details
PRMT5-MTA-IN-4
orb3135141-01 10 mg

PRMT5-MTA-IN-4

Sign In for Pricing
View Details
PRMT5-MTA-IN-4
orb3135141-02 50 mg

PRMT5-MTA-IN-4

Sign In for Pricing
View Details
P75 - TNFR Fragment
5-01690 4x 5 mg

P75 - TNFR Fragment

Sign In for Pricing
View Details
Lentiviral mouse Srsf6 shRNA (UAS) - Lentiviral mouse Srsf6 shRNA (UAS, RFP) (100)
GTR15150168 1 Vial

Lentiviral mouse Srsf6 shRNA (UAS) - Lentiviral mouse Srsf6 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details