C9orf106 Peptide - N-terminal region
C9orf106 Peptide - N-terminal region
Product Specifications
Product Name Alternative
BA65J3.5
UniProt
Q8NAJ2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C9orf106 Rabbit Polyclonal Antibody (orb326943) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001012733
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FSPRPLPRLWPLPGTPFLPIRALPFSASSSGKSSLVPSPSSSAHSGFRTP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400276-500 1x 500 µL
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040304-500 1x 500 µL
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400276-100 1x 100 µL
TAG-72 / CA72.4 (B72.3), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details