Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZYG11A Peptide - C-terminal region

ZYG11A Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZYG11

UniProt

Q6WRX3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZYG11A Rabbit Polyclonal Antibody (orb587316) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004339

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEQTAQLEELFMAVKELLAIVKQKTTENLDDVTFLFTLKALWNLTDGSPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lymphoid tissue
CR562113 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
FGFR1 (NM_023108) Human Recombinant Protein
TP314979M 100 µg

FGFR1 (NM_023108) Human Recombinant Protein

Sign In for Pricing
View Details
NR2F6 Human Gene Knockout Kit (CRISPR)
KN201336RB 1 Kit

NR2F6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FAM20C Human Gene Knockout Kit (CRISPR)
KN207945RB 1 Kit

FAM20C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NXNL1 Polyclonal Antibody
E-AB-52711-01 20 µL

NXNL1 Polyclonal Antibody

Sign In for Pricing
View Details
NXNL1 Polyclonal Antibody
E-AB-52711-02 60 µL

NXNL1 Polyclonal Antibody

Sign In for Pricing
View Details