Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZYG11A Peptide - C-terminal region

ZYG11A Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZYG11

UniProt

Q6WRX3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZYG11A Rabbit Polyclonal Antibody (orb587316) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001004339

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PEQTAQLEELFMAVKELLAIVKQKTTENLDDVTFLFTLKALWNLTDGSPA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ceruloplasmin Antibody
KC-28854-01 50 μL

Ceruloplasmin Antibody

Sign In for Pricing
View Details
Ceruloplasmin Antibody
KC-28854-02 100 µL

Ceruloplasmin Antibody

Sign In for Pricing
View Details
Ceruloplasmin Antibody
KC-28854-03 1 mL

Ceruloplasmin Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS801243 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
IRAKM (IRAK3) (N-term) Rabbit Polyclonal Antibody
AP14603PU-N 400 µL

IRAKM (IRAK3) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD41a (ITGA2B/1036), 0.2mg/mL
BNUB1036-100 1x 100 µL

CD41a (ITGA2B/1036), 0.2mg/mL

Sign In for Pricing
View Details