Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMIM23 Peptide - C-terminal region

SMIM23 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C5orf50

UniProt

A6NLE4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SMIM23 Rabbit Polyclonal Antibody (orb326947) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_933155

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: REHKDFPVESGKRAELPAQTDMSQSQGSSWKHKDQEKEGRVKTLAQDLAR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Lars2 shRNA (UAS) - Lentiviral mouse Lars2 shRNA (UAS) (100)
GTR15296205 1 Vial

Lentiviral mouse Lars2 shRNA (UAS) - Lentiviral mouse Lars2 shRNA (UAS) (100)

Sign In for Pricing
View Details
(4S,5S) -1,2-Dithiane-4,5-Diol
RG-D092002-01 10 mg

(4S,5S) -1,2-Dithiane-4,5-Diol

Sign In for Pricing
View Details
(4S,5S) -1,2-Dithiane-4,5-Diol
RG-D092002-02 25 mg

(4S,5S) -1,2-Dithiane-4,5-Diol

Sign In for Pricing
View Details
(4S,5S) -1,2-Dithiane-4,5-Diol
RG-D092002-03 50 mg

(4S,5S) -1,2-Dithiane-4,5-Diol

Sign In for Pricing
View Details
(4S,5S) -1,2-Dithiane-4,5-Diol
RG-D092002-04 100 mg

(4S,5S) -1,2-Dithiane-4,5-Diol

Sign In for Pricing
View Details
Pnliprp1 sgRNA CRISPR Lentivector set (Mouse)
K3392101 3x 1.0 µg

Pnliprp1 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details