C4orf51 Peptide - C-terminal region
C4orf51 Peptide - C-terminal region
Product Specifications
UniProt
C9J302
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C4orf51 Rabbit Polyclonal Antibody (orb587326) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001074000
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ITRPFKKSFDVKHGVAHQIWDFGDCFPTPPNYGKYCVRPKKPAQEALINY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC741366-100 1x 100 µL
Adipophilin / Perilipin-2 (Marker of Obesity) (ADFP/1366), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680893-500 1x 500 µL
Myosin, Smooth Muscle Heavy Chain (SMMS-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details