Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRSS56 Peptide - N-terminal region

PRSS56 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MCOP6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRSS56 Rabbit Polyclonal Antibody (orb587329) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

EAW71002

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PLSFLRLSCRSTRSAPNELLWTVTLAEGSRGEQAEEVPVNRILPHPKFDP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOMM5 (NM_001134485) Human Tagged ORF Clone
RC225003 10 µg

TOMM5 (NM_001134485) Human Tagged ORF Clone

Sign In for Pricing
View Details
Inorganic pyrophosphatase
MBS2889233 Inquire

Inorganic pyrophosphatase

Sign In for Pricing
View Details
Recombinant Bovine Pantothenate kinase 3 (PANK3)
MBS1362604-01 0.02 mg (E-Coli)

Recombinant Bovine Pantothenate kinase 3 (PANK3)

Sign In for Pricing
View Details
Recombinant Bovine Pantothenate kinase 3 (PANK3)
MBS1362604-02 0.02 mg (Yeast)

Recombinant Bovine Pantothenate kinase 3 (PANK3)

Sign In for Pricing
View Details
Recombinant Bovine Pantothenate kinase 3 (PANK3)
MBS1362604-03 0.1 mg (E-Coli)

Recombinant Bovine Pantothenate kinase 3 (PANK3)

Sign In for Pricing
View Details
Recombinant Bovine Pantothenate kinase 3 (PANK3)
MBS1362604-04 0.1 mg (Yeast)

Recombinant Bovine Pantothenate kinase 3 (PANK3)

Sign In for Pricing
View Details