XAGE1A Peptide - middle region
XAGE1A Peptide - middle region
Product Specifications
Product Name Alternative
CTP9, XAGE1, CT12.1, GAGED2, XAGE-1, XAGE1B, CT12.1A, CT12.1B
UniProt
Q9HD64
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with XAGE1A Rabbit Polyclonal Antibody (orb326951) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001091064
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HERHTQTQNHTASPRSPVMESPKKKNQQLKVGILHLGSRQKKIRIQLRSQ
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1128745-01 0.02 mg (E-Coli)
Recombinant Schizosaccharomyces pombe DNA-directed RNA polymerases I, II, and III subunit RPABC4 (rpc10)
Sign In for Pricing
View Details 
MBS1128745-02 0.1 mg (E-Coli)
Recombinant Schizosaccharomyces pombe DNA-directed RNA polymerases I, II, and III subunit RPABC4 (rpc10)
Sign In for Pricing
View Details MBS1128745-03 0.02 mg (Yeast)
Recombinant Schizosaccharomyces pombe DNA-directed RNA polymerases I, II, and III subunit RPABC4 (rpc10)
Sign In for Pricing
View Details 
MBS1128745-04 0.1 mg (Yeast)
Recombinant Schizosaccharomyces pombe DNA-directed RNA polymerases I, II, and III subunit RPABC4 (rpc10)
Sign In for Pricing
View Details MBS1128745-05 0.02 mg (Baculovirus)
Recombinant Schizosaccharomyces pombe DNA-directed RNA polymerases I, II, and III subunit RPABC4 (rpc10)
Sign In for Pricing
View Details 
MBS1128745-06 1 mg (E-Coli)
Recombinant Schizosaccharomyces pombe DNA-directed RNA polymerases I, II, and III subunit RPABC4 (rpc10)
Sign In for Pricing
View Details