XAGE1A Peptide - middle region
XAGE1A Peptide - middle region
Product Specifications
Product Name Alternative
CTP9, XAGE1, CT12.1, GAGED2, XAGE-1, XAGE1B, CT12.1A, CT12.1B
UniProt
Q9HD64
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with XAGE1A Rabbit Polyclonal Antibody (orb326951) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001091064
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: HERHTQTQNHTASPRSPVMESPKKKNQQLKVGILHLGSRQKKIRIQLRSQ
More Discoveries
Explore Other Products
Browse additional items from our catalog
K0609903 1.0 µg DNA
DMRT2 sgRNA CRISPR Lentivector (Human) (Target 2)
Sign In for Pricing
View Details 
MBS7150587 Inquire
Rabbit anti-Escherichia coli (strain K12) SECE Polyclonal Antibody
Sign In for Pricing
View Details