CENPBD1 Peptide - N-terminal region
CENPBD1 Peptide - N-terminal region
Product Specifications
UniProt
B2RD01
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CENPBD1 Rabbit Polyclonal Antibody (orb587332) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_659476
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ATIRDSKEKIKASSQIATPLRASRLTRHRSAVMESMEQLLSLWLEDQSQP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC403185-500 1x 500 µL
Adipophilin / Perilipin-2 (Marker of Lipid Accumulation) (rADFP/1493), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![BLNK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B2]](https://cdn.genprice.uk/products/937/68dd1b80061270361ea1e34a/imageurl/ta808522bm.webp)
TA808522BM 100 µL
BLNK Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B2]
Sign In for Pricing
View Details