CENPBD1 Peptide - N-terminal region
CENPBD1 Peptide - N-terminal region
Product Specifications
UniProt
B2RD01
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CENPBD1 Rabbit Polyclonal Antibody (orb587332) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_659476
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ATIRDSKEKIKASSQIATPLRASRLTRHRSAVMESMEQLLSLWLEDQSQP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
PKSQ050037-01 10 µg
Recombinant Cynomolgus FcRn/FCGRT & B2M Heterodimer Protein (Flag & His Tag)
Sign In for Pricing
View Details PKSQ050037-02 50 µg
Recombinant Cynomolgus FcRn/FCGRT & B2M Heterodimer Protein (Flag & His Tag)
Sign In for Pricing
View Details