CENPL Peptide - N-terminal region
CENPL Peptide - N-terminal region
Product Specifications
Product Name Alternative
C1orf155, CENP-L, RP3-383J4.1, dJ383J4.3
UniProt
Q8N0S6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CENPL Rabbit Polyclonal Antibody (orb587333) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_201576
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: AVEVGEDFNIKVIFSTLLGMKGTQRDPEAFLVQIVSKSQLPSENREGKVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AS09 481-DL488 40 µg
Anti-BiP | Lumenal-binding protein, DyLight® 488 conjugated (40 µg)
Sign In for Pricing
View Details 
BNC471674-500 1x 500 µL
TNF-alpha (Tumor Necrosis Factor alpha), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 