Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLEC18B Peptide - C-terminal region

CLEC18B Peptide - C-terminal region

Product Specifications

Product Name Alternative

MRCL2

UniProt

Q8NCF0

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLEC18B Rabbit Polyclonal Antibody (orb326954) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001011880

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLRIDGDCFMVSSEADTYYRARMKCQRKGGVLAQIKSQKVQDILAFYLGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ibandronic Acid
TRC-I120000-50MG 50 mg

Ibandronic Acid

Sign In for Pricing
View Details
3-Bromophenanthrene
TRC-B678858-1MG 1 mg

3-Bromophenanthrene

Sign In for Pricing
View Details
beta Defensin 1 (DEFB1) (NM_005218) Human Recombinant Protein
TP720106XL 1 mg

beta Defensin 1 (DEFB1) (NM_005218) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Genomic DNA, Liver
CD564801 5 µg

Tissue Genomic DNA, Liver

Sign In for Pricing
View Details
Human TLCD1 activation kit by CRISPRa
GA114580 1 Kit

Human TLCD1 activation kit by CRISPRa

Sign In for Pricing
View Details
AGTRAP (NM_001040194) Human Over-expression Lysate
LY421720 100 µg

AGTRAP (NM_001040194) Human Over-expression Lysate

Sign In for Pricing
View Details