CLEC18B Peptide - C-terminal region
CLEC18B Peptide - C-terminal region
Product Specifications
Product Name Alternative
MRCL2
UniProt
Q8NCF0
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CLEC18B Rabbit Polyclonal Antibody (orb326954) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001011880
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DLRIDGDCFMVSSEADTYYRARMKCQRKGGVLAQIKSQKVQDILAFYLGR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472924-500 1x 500 µL
Uroplakin 1A (Urothelial Differentiation Marker) (UPK1A/2924), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC741432-500 1x 500 µL
Clathrin, Heavy Chain (CHC/1432), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![APC Anti-Rat CD44H Antibody[OX-49]](https://cdn.genprice.uk/products/763/68dd14af061270361e7d3927/imageurl/e-ab-f1225e.webp)