Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLRN3 Peptide - middle region

CLRN3 Peptide - middle region

Product Specifications

Product Name Alternative

TMEM12, USH3AL1

UniProt

Q8NCR9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLRN3 Rabbit Polyclonal Antibody (orb587336) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689524

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQSNQLSEELFQMLYPATTSKGTTHSYGYSFWLILLVILLNIVTVTIIIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ACSL5 Polyclonal Antibody
HV429014-01 50 µg

Anti-ACSL5 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-ACSL5 Polyclonal Antibody
HV429014-02 100 µg

Anti-ACSL5 Polyclonal Antibody

Sign In for Pricing
View Details
GPR156 Protein Vector (Rat) (pPM-C-HA)
PV271128 500 ng

GPR156 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
CLRN2 Antibody, FITC conjugated
CSB-PA005584LC01HU-01 50 µg

CLRN2 Antibody, FITC conjugated

Sign In for Pricing
View Details
CLRN2 Antibody, FITC conjugated
CSB-PA005584LC01HU-02 100 µg

CLRN2 Antibody, FITC conjugated

Sign In for Pricing
View Details
BAD (Ab-91/128) Antibody
orb758301-01 25 µg

BAD (Ab-91/128) Antibody

Sign In for Pricing
View Details