Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLRN3 Peptide - middle region

CLRN3 Peptide - middle region

Product Specifications

Product Name Alternative

TMEM12, USH3AL1

UniProt

Q8NCR9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLRN3 Rabbit Polyclonal Antibody (orb587336) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_689524

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TQSNQLSEELFQMLYPATTSKGTTHSYGYSFWLILLVILLNIVTVTIIIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DBI peptide
orb256779-01 1 mg

DBI peptide

Sign In for Pricing
View Details
DBI peptide
orb256779-02 5 mg

DBI peptide

Sign In for Pricing
View Details
DEFA3, CT (DEFA3, DEF3, Neutrophil defensin 3, Defensin, alpha 3, HNP-3, HP 3-56, Neutrophil defensin 2, HNP-2) (MaxLight 405) discontinued
034571-ML405 100 µL

DEFA3, CT (DEFA3, DEF3, Neutrophil defensin 3, Defensin, alpha 3, HNP-3, HP 3-56, Neutrophil defensin 2, HNP-2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Ethyl phenylglyoxylate
orb1306680 1 g

Ethyl phenylglyoxylate

Sign In for Pricing
View Details
ADAMDEC1 (ADAM DEC1, A Disintegrin and Metalloproteinase Domain-like Protein Decysin-1, ADAM-like Protein Decysin-1) (PE)
122977-PE 100 µL

ADAMDEC1 (ADAM DEC1, A Disintegrin and Metalloproteinase Domain-like Protein Decysin-1, ADAM-like Protein Decysin-1) (PE)

Sign In for Pricing
View Details
Petesicatib
orb1706826-01 1 mg

Petesicatib

Sign In for Pricing
View Details