Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COPZ1 Peptide - C-terminal region

COPZ1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

COPZ, zeta1-COP

UniProt

P61923

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COPZ1 Rabbit Polyclonal Antibody (orb587338) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057141

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DEIVDGGVILESDPQQVVHRVALRGEDVPLTEQTVSQVLQSAKEQIKWSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CaMKII (Thr287) Rabbit Polyclonal Antibody (BF405)
orb2499490 100 µL

Phospho-CaMKII (Thr287) Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Pki α CRISPR/Cas9 KO Plasmid (h)
sc-416391 20 µg

Pki α CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Olfr119 (NM_001011830) Mouse Tagged Lenti ORF Clone
MR213921L4 10 µg

Olfr119 (NM_001011830) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human CCDC104 / Coiled-coil domain-containing protein 104 Recombinant Protein
R7759h 1 Each

Human CCDC104 / Coiled-coil domain-containing protein 104 Recombinant Protein

Sign In for Pricing
View Details
Mouse Monoclonal Layilin Antibody (OTI4C11) [FITC]
NBP2-72402F 0.1 mL

Mouse Monoclonal Layilin Antibody (OTI4C11) [FITC]

Sign In for Pricing
View Details
PSMB11 ORF Vector (Human) (pORF)
37955011 1.0 µg DNA

PSMB11 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details