Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CT47A7 Peptide - C-terminal region

CT47A7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CT47.7

UniProt

Q5JQC4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CT47A7 Rabbit Polyclonal Antibody (orb326957) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073609

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PDAEEPATEEPTAQEATAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

α, ω-Bis-Hydroxy PEG
1110000-0.5G 5 g

α, ω-Bis-Hydroxy PEG

Sign In for Pricing
View Details
ZNF2 Mouse Monoclonal Antibody [Clone ID: OTI1G3]
CF811013 100 µg

ZNF2 Mouse Monoclonal Antibody [Clone ID: OTI1G3]

Sign In for Pricing
View Details
NIBAN2 Rabbit Polyclonal Antibody
AP08078PU-S 50 µL

NIBAN2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rps6kb1 Mouse Gene Knockout Kit (CRISPR)
KN515113 1 Kit

Rps6kb1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-500 1x 500 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
XFD488 NHS Ester
71902-AAT 5 mg

XFD488 NHS Ester

Sign In for Pricing
View Details