Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CT47A7 Peptide - C-terminal region

CT47A7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CT47.7

UniProt

Q5JQC4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CT47A7 Rabbit Polyclonal Antibody (orb326957) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001073609

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PDAEEPATEEPTAQEATAPEEVTKSQPEKWDEEAQDAAGEEEKEQEKEKD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lung
CS622320 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
NEK3 (NM_001146099) Human Over-expression Lysate
LC431430 20 µg

NEK3 (NM_001146099) Human Over-expression Lysate

Sign In for Pricing
View Details
CLN6 Antibody
8C15062-AAT 50 µg

CLN6 Antibody

Sign In for Pricing
View Details
KIAA1731 (CEP295) Human Gene Knockout Kit (CRISPR)
KN426487 1 Kit

KIAA1731 (CEP295) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Prostate Secretory Protein Antibody
KC-2500-01 50 μL

Prostate Secretory Protein Antibody

Sign In for Pricing
View Details
Prostate Secretory Protein Antibody
KC-2500-02 100 µL

Prostate Secretory Protein Antibody

Sign In for Pricing
View Details