Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aste1 Peptide - C-terminal region

Aste1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1100001A21Rik, AV006403

UniProt

Q8BIR2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Aste1 Rabbit Polyclonal Antibody (orb576283) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079927

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TKSYAPAELFLPKTKSKSKKKRQKKKVASLGTTADAKHWYDRSNRFGPLM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ART3 (125.1)
sc-81993 100 µg/mL

ART3 (125.1)

Sign In for Pricing
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PGIP2 Polyclonal Antibody
MBS9010379 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) PGIP2 Polyclonal Antibody

Sign In for Pricing
View Details
Goose Tartrate Resistant Acid Phosphatase 5B ELISA Kit
MBS030484 Inquire

Goose Tartrate Resistant Acid Phosphatase 5B ELISA Kit

Sign In for Pricing
View Details
Tmem30b Mouse shRNA Plasmid (Locus ID 238257)
TR514836 1 Kit

Tmem30b Mouse shRNA Plasmid (Locus ID 238257)

Sign In for Pricing
View Details
Apcin 2mg
A22096-2 2 mg

Apcin 2mg

Sign In for Pricing
View Details
pDC316-mCMV-EGFP-CMV-Epdr1-HA Plasmid
PVT48708 2 µg

pDC316-mCMV-EGFP-CMV-Epdr1-HA Plasmid

Sign In for Pricing
View Details