Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Anxa13 Peptide - C-terminal region

Anxa13 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1810034H17Rik, AV055219

UniProt

Q99JG3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Anxa13 Rabbit Polyclonal Antibody (orb578626) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_081487

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLYKAMKGMGTDEETLIRIIVTRAEVDLQGIKAKFQEKYQKSLSDMVHSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal HSPH1/HSP105 Antibody [DyLight 488]
NBP2-97291G 0.1 mL

Rabbit Polyclonal HSPH1/HSP105 Antibody [DyLight 488]

Sign In for Pricing
View Details
ARID3A Adenovirus (Human)
12354051 1.0 mL

ARID3A Adenovirus (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal PSMD6 Antibody
NBP3-30530 100 µg

Rabbit Polyclonal PSMD6 Antibody

Sign In for Pricing
View Details
Mir345 Mouse MicroRNA Expression Plasmid (MI0000632)
SC401004 10 µg

Mir345 Mouse MicroRNA Expression Plasmid (MI0000632)

Sign In for Pricing
View Details
Rabbit Anti-Human PP2A alpha + beta mAb
MA1269-01 50 μL

Rabbit Anti-Human PP2A alpha + beta mAb

Sign In for Pricing
View Details
Rabbit Anti-Human PP2A alpha + beta mAb
MA1269-02 100 μL

Rabbit Anti-Human PP2A alpha + beta mAb

Sign In for Pricing
View Details