Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnalc1 Peptide - C-terminal region

Dnalc1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1700010H15Rik, AW121714, Dnal1, E330027P08Rik, Dnalc1

UniProt

Q05A62

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnalc1 Rabbit Polyclonal Antibody (orb326414) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_083097

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEFLKLAELPCLEDLVFVGNPLEEKHSAEGNWIDEATKRVPKLKKLDGTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oct-4 Antibody
CST 2750S 100 µL

Oct-4 Antibody

Sign In for Pricing
View Details
Osterix
549104 200 µL

Osterix

Sign In for Pricing
View Details
Human VEGF165 Mouse Monoclonal Antibody (HRP)
orb2364599 100 µL

Human VEGF165 Mouse Monoclonal Antibody (HRP)

Sign In for Pricing
View Details
Goat 12-Hydroxyeicosatetraenoic Acid (12-HETE) ELISA Kit
NSL1277Gt 96 Tests

Goat 12-Hydroxyeicosatetraenoic Acid (12-HETE) ELISA Kit

Sign In for Pricing
View Details
NEURL2 Antibody
orb2681335-01 50 µL

NEURL2 Antibody

Sign In for Pricing
View Details
NEURL2 Antibody
orb2681335-02 100 µL

NEURL2 Antibody

Sign In for Pricing
View Details