Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnalc1 Peptide - C-terminal region

Dnalc1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

1700010H15Rik, AW121714, Dnal1, E330027P08Rik, Dnalc1

UniProt

Q05A62

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnalc1 Rabbit Polyclonal Antibody (orb326414) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_083097

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AEFLKLAELPCLEDLVFVGNPLEEKHSAEGNWIDEATKRVPKLKKLDGTP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Clostridium perfringens Phospholipase C (plc), C-His
VG9C218-01 1 mg

Recombinant Clostridium perfringens Phospholipase C (plc), C-His

Sign In for Pricing
View Details
Recombinant Clostridium perfringens Phospholipase C (plc), C-His
VG9C218-02 100 µg

Recombinant Clostridium perfringens Phospholipase C (plc), C-His

Sign In for Pricing
View Details
Recombinant Bovine Cytochrome c-type heme lyase (HCCS)
MBS1036528-01 0.02 mg (E-Coli)

Recombinant Bovine Cytochrome c-type heme lyase (HCCS)

Sign In for Pricing
View Details
Recombinant Bovine Cytochrome c-type heme lyase (HCCS)
MBS1036528-02 0.02 mg (Yeast)

Recombinant Bovine Cytochrome c-type heme lyase (HCCS)

Sign In for Pricing
View Details
Recombinant Bovine Cytochrome c-type heme lyase (HCCS)
MBS1036528-03 0.1 mg (E-Coli)

Recombinant Bovine Cytochrome c-type heme lyase (HCCS)

Sign In for Pricing
View Details
Recombinant Bovine Cytochrome c-type heme lyase (HCCS)
MBS1036528-04 0.1 mg (Yeast)

Recombinant Bovine Cytochrome c-type heme lyase (HCCS)

Sign In for Pricing
View Details