Fgfr1 Peptide - N-terminal region
Fgfr1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
AW208770, Eask, FLG, Fgfr-1, Flt-2, Hspy
UniProt
P16092
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Fgfr1 Rabbit Polyclonal Antibody (orb585522) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_034336
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: TYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKM
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC402769 20 µg
ADCK3 (COQ8A) (NM_020247) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC942495-100 1x 100 µL
Lactoylglutathione Lyase (CPTC-GLO1-3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
GM-31-5 1 mL
Colloidal Gold Conjugated Monoclonal Antibody to Neurofilament, 5nm
Sign In for Pricing
View Details