Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fgfr1 Peptide - N-terminal region

Fgfr1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

AW208770, Eask, FLG, Fgfr-1, Flt-2, Hspy

UniProt

P16092

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fgfr1 Rabbit Polyclonal Antibody (orb585522) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034336

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNOT7 Human Gene Knockout Kit (CRISPR)
KN209293RB 1 Kit

CNOT7 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CANT1 (N-term) Rabbit Polyclonal Antibody
AP17919PU-N 400 µL

CANT1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TCEAL2 (NM_080390) Human Recombinant Protein
TP311139M 100 µg

TCEAL2 (NM_080390) Human Recombinant Protein

Sign In for Pricing
View Details
Bop1 Mouse Gene Knockout Kit (CRISPR)
KN502225 1 Kit

Bop1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human FGF-23 protein (His Tag)
PKSH034162-01 20 µg

Recombinant Human FGF-23 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FGF-23 protein (His Tag)
PKSH034162-02 100 µg

Recombinant Human FGF-23 protein (His Tag)

Sign In for Pricing
View Details