Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Akirin2 Peptide - C-terminal region

Akirin2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2700059D21Rik, AA114675, AA522011, AU019887, Akirin-2

UniProt

B1AXD8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Akirin2 Rabbit Polyclonal Antibody (orb586526) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007590

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Breast carcinoma amplified sequence 1 (BCAS1) ELISA kit
GTR10411928 96 Well

Bovine Breast carcinoma amplified sequence 1 (BCAS1) ELISA kit

Sign In for Pricing
View Details
Caffeine
2793/100 100 mg

Caffeine

Sign In for Pricing
View Details
PPP1CC, CT (PPP1CC, Serine/threonine-protein phosphatase PP1-gamma catalytic subunit, Protein phosphatase 1C catalytic subunit) (Biotin) discontinued
040334-Biotin 200 µL

PPP1CC, CT (PPP1CC, Serine/threonine-protein phosphatase PP1-gamma catalytic subunit, Protein phosphatase 1C catalytic subunit) (Biotin) discontinued

Sign In for Pricing
View Details
STK31 siRNA (Human)
CRJ1100-01 15 nmol

STK31 siRNA (Human)

Sign In for Pricing
View Details
STK31 siRNA (Human)
CRJ1100-02 30 nmol

STK31 siRNA (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal Cav1.2 Antibody
NBP3-14555 50 µg

Rabbit Polyclonal Cav1.2 Antibody

Sign In for Pricing
View Details