Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Akirin2 Peptide - C-terminal region

Akirin2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2700059D21Rik, AA114675, AA522011, AU019887, Akirin-2

UniProt

B1AXD8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Akirin2 Rabbit Polyclonal Antibody (orb586526) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001007590

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC88A ORF Vector (Human) (pORF)
15322011 1.0 µg DNA

CCDC88A ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Fumarase (FUM), Recombinant, Human, His-Tag
049462-01 10 µg

Fumarase (FUM), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Fumarase (FUM), Recombinant, Human, His-Tag
049462-02 50 µg

Fumarase (FUM), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Fumarase (FUM), Recombinant, Human, His-Tag
049462-03 100 µg

Fumarase (FUM), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Fumarase (FUM), Recombinant, Human, His-Tag
049462-04 200 µg

Fumarase (FUM), Recombinant, Human, His-Tag

Sign In for Pricing
View Details
Vasodilator Stimulated Phosphoprotein, phosphorylated (VASP) (Ser239) (FITC) discontinued
V2118-FITC 100 µL

Vasodilator Stimulated Phosphoprotein, phosphorylated (VASP) (Ser239) (FITC) discontinued

Sign In for Pricing
View Details