Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lingo2 Peptide - C-terminal region

Lingo2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B230217C06Rik, Lern3, Lrrn6c

UniProt

Q3URE9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Lingo2 Rabbit Polyclonal Antibody (orb586620) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_780725

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTILVSTAMGCFTFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uridine-2-13C-1,3-15N2
TRC-U829907-1MG 1 mg

Uridine-2-13C-1,3-15N2

Sign In for Pricing
View Details
Rat SELP (P-Selectin) ELISA Kit
E-EL-R3045-01 24 Tests

Rat SELP (P-Selectin) ELISA Kit

Sign In for Pricing
View Details
Rat SELP (P-Selectin) ELISA Kit
E-EL-R3045-02 48 Tests

Rat SELP (P-Selectin) ELISA Kit

Sign In for Pricing
View Details
Rat SELP (P-Selectin) ELISA Kit
E-EL-R3045-03 96 Tests

Rat SELP (P-Selectin) ELISA Kit

Sign In for Pricing
View Details
PTBP1 Mouse Monoclonal Antibody [9A1]
EM1701-63 100 µL

PTBP1 Mouse Monoclonal Antibody [9A1]

Sign In for Pricing
View Details
Low Abundance DNA Quantification Kit
57200 48 Samples

Low Abundance DNA Quantification Kit

Sign In for Pricing
View Details