Lingo2 Peptide - C-terminal region
Lingo2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
B230217C06Rik, Lern3, Lrrn6c
UniProt
Q3URE9
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Lingo2 Rabbit Polyclonal Antibody (orb586620) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_780725
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KTILVSTAMGCFTFLGVVLFCFLLLFVWSRGKGKHKNSIDLEYVPRKNNG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TP762323 50 µg
Lymphocyte Activation Gene 3 (LAG3) (NM_002286) Human Recombinant Protein
Sign In for Pricing
View Details 
BNC942618-500 1x 500 µL
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2618), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402688-100 1x 100 µL
GATA-3 (Breast and Urothelial Marker) (GATA3/2688), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details